PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.TGY3R
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 263aa    MW: 29191.5 Da    PI: 6.0183
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.TGY3RgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.31.3e-11195237246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ eEd ++  + +  G++ W+ Ia+ ++  Rt++++k++w++
      Aradu.TGY3R 195 GEFSDEEDRIICSLYANIGSR-WSIIAAQLP-ERTDNDIKNYWNT 237
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.60.10.107.4E-116373IPR005135Endonuclease/exonuclease/phosphatase
SuperFamilySSF562194.6E-792207IPR005135Endonuclease/exonuclease/phosphatase
Gene3DG3DSA:3.60.10.107.4E-11150193IPR005135Endonuclease/exonuclease/phosphatase
SuperFamilySSF466891.06E-12185243IPR009057Homeodomain-like
PROSITE profilePS5129416.784189243IPR017930Myb domain
SMARTSM007173.5E-10193241IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-19194243IPR009057Homeodomain-like
PfamPF002492.0E-10195237IPR001005SANT/Myb domain
CDDcd001671.34E-7196237No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MLLSLLLLAP PGLLLSVAAI APPTLVLLRS LSIDGCIAGI STMAVTVHLP SDFSLYFSFS  60
QIPKVVQRLW LVGSYWCLCS GEQLRRGGMD EMAVLSSSDS LATKDYYLAT TGSGRSGQDG  120
QLQGRLDAGN IKEAELSLRE AGCLNYEILT DVVSGTYRII WLGDLNYRIA LSYRSAKALV  180
EMQNWRALLE NDQHGEFSDE EDRIICSLYA NIGSRWSIIA AQLPERTDND IKNYWNTKLK  240
KKLMALLPSH HHNQQNPPPF ISD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0972462e-34BT097246.1 Soybean clone JCVI-FLGm-21D22 unknown mRNA.
GenBankKT0312652e-34KT031265.1 Glycine max clone HN_CCL_53 MYB/HD-like transcription factor (Glyma13g20510.1_like1) mRNA, partial cds.
GenBankKT0312662e-34KT031266.1 Glycine max clone HN_CCL_52 MYB/HD-like transcription factor (Glyma13g20510.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015935727.18e-33PREDICTED: transcription factor RAX2-like, partial
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-24myb domain protein 36